PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00797.1.g00010.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB_related
Protein Properties Length: 258aa    MW: 27957.1 Da    PI: 7.289
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00797.1.g00010.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.28.2e-18344245
                                  SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                                  ++WT++Ed  l++a+k +G++ W++Ia++++ gR+++ +k++w+
  Zjn_sc00797.1.g00010.1.sm.mk  3 DAWTEDEDRMLINAHKFYGNR-WSSIAKYLP-GRSENAIKNHWN 44
                                  58*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007173.4E-16149IPR001005SANT/Myb domain
PROSITE profilePS5129423.8151IPR017930Myb domain
SuperFamilySSF466891.79E-15251IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-19448IPR009057Homeodomain-like
PfamPF002493.4E-16444IPR001005SANT/Myb domain
CDDcd001671.19E-15447No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
QNDAWTEDED RMLINAHKFY GNRWSSIAKY LPGRSENAIK NHWNATLRSL KAQRRMKKRK  60
SEQVPTGQFS ALEEYIRSQW PKDAVPAAPP PLPLSAPQPH LAYGSGLLHP AAHAPAAGSA  120
TIPTNREMSF HGDNLAAGSA NLAGMINLNM PQTLPDLNTI SGRQEYYLNY ATMYAPAPAP  180
QMHLTPTQDP MQVVSNLDLS PYAEYFALLC PDYGRYNYAS ASSSNPAGAN GYYNEAGRGA  240
AGAGGGDPAA RHTDGVVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1idy_A7e-18148451MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3
1idz_A7e-18148451MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15259QRRMKKRK
25359RRMKKRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972257.15e-55PREDICTED: uncharacterized protein LOC101784221
TrEMBLK3XS586e-55K3XS58_SETIT; Uncharacterized protein
STRINGSi004755m2e-54(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40360.15e-19myb domain protein 115